PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna22510.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 156aa    MW: 17585.7 Da    PI: 5.7432
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna22510.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.35e-496100296
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              +eqdr+lPianv+rimk+ lP++ak+sk+ak+ +qec++ef+sfvt+easdkc++e+rkt+ngdd++wa++ lGf++y+e+ + yl
  mrna22510.1-v1.0-hybrid   6 EEQDRLLPIANVGRIMKQGLPQRAKVSKEAKQRMQECATEFLSFVTAEASDKCHKENRKTVNGDDICWAMSALGFDNYAEATTRYL 91 
                              69************************************************************************************ PP

                    NF-YB  88 kkyrelege 96 
                              +kyre+e++
  mrna22510.1-v1.0-hybrid  92 NKYREAERH 100
                              ******997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-465108IPR009072Histone-fold
SuperFamilySSF471134.35E-368114IPR009072Histone-fold
PfamPF008082.1E-241175IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-173957No hitNo description
PRINTSPR006151.0E-175876No hitNo description
PRINTSPR006151.0E-177795No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MVDHEEEQDR LLPIANVGRI MKQGLPQRAK VSKEAKQRMQ ECATEFLSFV TAEASDKCHK  60
ENRKTVNGDD ICWAMSALGF DNYAEATTRY LNKYREAERH RLAANQSNIN INTSSSSQLE  120
IREGDQLPIY LSGTQPSNLE FRILEMGDNS FAKPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-42796392Transcription factor HapC (Eurofung)
4g92_B7e-42796392Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302413.11e-115PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040279e-52NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A067JU241e-60A0A067JU24_JATCU; Uncharacterized protein
STRINGPOPTR_0013s02030.15e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.14e-52nuclear factor Y, subunit B4